General Information

  • ID:  hor006440
  • Uniprot ID:  P68004
  • Protein name:  Peptide YY
  • Gene name:  PYY
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
  • Length:  34
  • Propeptide:  YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
  • Signal peptide:  NA
  • Modification:  T11 Phosphoserine;T34 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY1R
  • Target Unid:  O02813
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 15 minutes; /900 seconds ( PubMed ID: 17065394 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68004-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006440_AF2.pdbhor006440_ESM.pdb

Physical Information

Mass: 457017 Formula: C176H271N51O55
Absent amino acids: CFIMW Common amino acids: AELRY
pI: 7.52 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -107.35 Boman Index: -9946
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 66.18
Instability Index: 8857.94 Extinction Coefficient cystines: 5960
Absorbance 280nm: 180.61

Literature

  • PubMed ID:  2342986##17065394
  • Title:  Structural characterization of canine PYY.